PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01998.2.p
Common NameEUGRSUZ_I01998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 552aa    MW: 60499.6 Da    PI: 9.0892
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01998.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.34.2e-30296352259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vkg  fprsYY+C++ +C+vkkkve+s  d++++eitY+g+H+he
  Eucgr.I01998.2.p 296 EDGYNWRKYGQKQVKGCGFPRSYYKCSHLNCSVKKKVEHSL-DGRITEITYRGQHQHE 352
                       7****************************************.***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.1E-27290354IPR003657WRKY domain
PROSITE profilePS5081121.884290354IPR003657WRKY domain
SuperFamilySSF1182903.01E-24293354IPR003657WRKY domain
SMARTSM007743.7E-32295353IPR003657WRKY domain
PfamPF031061.1E-22296351IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MNTLFIKNLI YVFLASFDEV KQQKKNHYKK VGLLTELLLE SEDKKRLGQD GKWRWSAKTT  60
PAPVDTGLSQ RRKKLSQDMA GKQPPPPLRP TISVPPRPPA AAMFGPCASP GPLTLVSSFF  120
AESDGGSFSE LLAGAMYSPL AVNAAGPSSF LWDYPRENPS REGEPRDGQA GLPVGAVKSP  180
LFTVPPGLSP SGLLLSPGFF SPKSPFGMSH QQALAQVTAQ AHVALARSHE HSQLEINPPS  240
EASKEPLPDE PSLMPNEDSH QLSPSEATTS MAESSDFVSS SHKWEALPMV LEKPTEDGYN  300
WRKYGQKQVK GCGFPRSYYK CSHLNCSVKK KVEHSLDGRI TEITYRGQHQ HEMPQAKRTS  360
KDGNNLNRST NSLAKSQAVL QGQSGRQSAP AMLRSGQDEE SSQAIASNTS GLSNYVELDD  420
AKSKGDGSDV DNDDVDAGDD KSNPKQKQVL FMMFYIITVF LLVIFHFRQF NKLLWLIGLC  480
QFHQANMSQN PRSFCRQEVK LICWMMASSG ANMDRKWSKG VPTQGATTSA LTQAAMSGNI  540
LKGLRWTLNP L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-162973541674WRKY transcription factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01998.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029361.10.0PREDICTED: probable WRKY transcription factor 4 isoform X2
TrEMBLA0A059AQY10.0A0A059AQY1_EUCGR; Uncharacterized protein
STRINGVIT_14s0108g01280.t018e-93(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.14e-53WRKY DNA-binding protein 4